PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G125500.1.p
Common NameGLYMA_11G125500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 1005aa    MW: 111208 Da    PI: 6.1221
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G125500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.18.5e-29639689252
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          e+++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Glyma.11G125500.1.p 639 ENNVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 689
                          689**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.154621709IPR003035RWP-RK domain
PfamPF020422.6E-26641689IPR003035RWP-RK domain
SuperFamilySSF542775.23E-21901988No hitNo description
Gene3DG3DSA:3.10.20.2409.0E-23901983No hitNo description
PROSITE profilePS5174523.064904986IPR000270PB1 domain
SMARTSM006663.1E-22904986IPR000270PB1 domain
CDDcd064074.38E-30905985No hitNo description
PfamPF005642.8E-17907985IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1005 aa     Download sequence    Send to blast
MMRLLGCWLT RTKPLVQSLI QRNSNIGQIS TSIFLSNLIM EDHVSPEGKE VSCCTPPGAQ  60
LEEPTSVDGG MKKSASEDMF SNFSELMNFD TYAGWSNSPS MTDQSLANVF SSFSLAPYPV  120
PDVLNLVEHG NGPFFMTEDS EIHNDMESAP SCGERIIFQQ MDFQLGFLDE ANDSNSLDSK  180
QKPNGTSQEV NTTDMCNYII SSSPGRSLDD RMLRALSFFM ESADGGMLAQ VWVPIKHGDE  240
FILSTSEQPY LLDPKLAGYR EVSRAFTFSA EGKTQSCPGL PARVFISHVP EWTSNVGYYN  300
KTEYLRLEHA RNHEIRGSIA LPISDVHSQV PCAVLELVTT KEKPNFDREL EIVSQALQLV  360
NLRTTMPPRL HPQCLSSNKR AALTEIIDVL RAVCHAHRLP LALTWIPCCY SEGIRNETDR  420
IRIKEGHTSP NEKCVLCIEE SACYVNDGAV EGFVHACVEH HLEEGQGIAG KALQSNHPFF  480
YTDVKTYDIG EYPLVHHARK YNLNAAVAIR LRSTYTNDDD YILEFFLPVN MTGSSEQELL  540
LDNLSSTMRR ICKSLRTVSD AELTGIEGSQ GGFPKEKVSG FFPMSRRNSQ IAFISDDHDS  600
VLKMSLKASN MRNNGIEAVH SQTMNGSRKQ VEKKRSTVEN NVSLSVLQQY FSGSLKDAAK  660
SIGVCPTTLK RICRQHGISR WPSRKINKVN RSLKKIQTVL DSVQGVEGGL KFDPYTGGFI  720
AGGSIMQETE AHKYLVFPEK SSVKDPKPAT QKKVSVAPAP ASTIENSTIK LNDDEGVCLV  780
GNKLVHSRSI PNSNSGEGEL KKDNVSSDDS KSMTMNDGSC HKACHWKKTK DCPEQTCSMS  840
LVTDEVEVGV DRVEGADEHN HPTSSSTTNS SNGSGSMMHG SSSCSHENQK YSKVKSNCVD  900
SGSKMIVKAS YRGDTIRFKF DPSSGCFQLY KEVATRFKLQ NGSFQLKYLD DEEEWVMLVN  960
DSDLQECTEI LDDIGTRCVK FLVRDVPCVL SSHGSNSCFL SDSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2351720.0AC235172.1 Glycine max strain Williams 82 clone GM_WBb0002N17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003539038.10.0PREDICTED: protein NLP9-like
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLK7LPE30.0K7LPE3_SOYBN; Uncharacterized protein
STRINGGLYMA11G13390.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34643465
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein